The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative Xylose isomerase (YP_426450.1) from RHODOSPIRILLUM RUBRUM ATCC 11170 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3qxb Target Id 394507
    Molecular Characteristics
    Source Rhodospirillum rubrum atcc 11170
    Alias Ids TPS27867,YP_426450.1, _0074.000339_, 326816 Molecular Weight 33592.38 Da.
    Residues 297 Isoelectric Point 4.78
    Sequence mklgvnlcfavkrwlepdrlaglvrddlgleyvqytydltdpwwpdierdrraiayakafrkaglties tfgglasytynhflaptlelqslgyqhlkraidmtaamevpatgmpfgsysaadalnparreeiyaiar dmwielaayakrqglsmlyvepvplatefpssaadaarlmadldgrteipvrllvdwghalfeplfgpe admdhwmdlcqpwiaayhiqqtdgqldrhwsftqpgvvtpqrlqdfwdkyaltdqtffaeilypfeard edvladmiasvkalkaaspaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.1916
    Matthews' coefficent 2.14 Rfactor 0.1498
    Waters 976 Solvent Content 42.63

    Ligand Information



    Protein Summary

    [The following content, including  figures, is uploaded from Kevin Kai Jin's refinement summary, more discussion about this protein structure will be continuously added very soon]


    Pfam note: this protein is now incorporated into: AP_endonuc_2 PF01261 This family is part of the TIM barrell clan, and the family itself already has many structures resolved for it. The hit has a very high bit score. and best wishes


    Gene YP_426450.1 encodes a protein with 297 residues from RHODOSPIRILLUM RUBRUM ATCC 11170 with Isoelectric Point of 4.78, which belongs to PF01261 xylose isomerase with TIM alpha/beta barrel fold.  The NCI blast sequence alignment also indicates that this protein carries a  conserved domain of AP_endonuc_2, Xylose isomerase-like TIM barrel.  A structural homolog search via SSM and Dali sever show that this protein is a structural homolog to those xylose isomerase protein structures.  The interface interaction suggests that the biomolecule of protein YP_426450.1 be a dimer.





     Figure 1. Protein encoded by gene YP_426450.1

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    1172.01 kB19:46, 12 Oct 2009kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch