.
The Open Protein Structure Annotation Network
PDB Keyword
.

3r4i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Citrate lyase (Bxe_B2899) from BURKHOLDERIA XENOVORANS LB400 at 2.24 A resolution. To be published
    Site JCSG
    PDB Id 3r4i Target Id 397760
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS30732,YP_552446.1, _0053.003569_, 327885 Molecular Weight 37096.08 Da.
    Residues 338 Isoelectric Point 6.14
    Sequence mraltpaevlfdgevppavlpacdhyagseklmlkslalqqqlgpvfditldcedgaqvgreaqhaelv asllgsehdrfgrvgvrihdfdhahwrddvrlilraakrapayitlpkirhvhdaaemvafieatrrel giaqpvpvqllvethgaltrvfdlaalpgvealsfglmdfvsahdgaipdtamrspgqfdhplvrrakl eisaachaygkvpshnvstevrdmsvvandaararnefgytrmwsihpaqieaivaafaprdeeittat eillaaqsaqwgptryhdtlhdrasyryywsvlrraqatgravpqdaaplftkvgtnvqaas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.24 Rfree 0.1737
    Matthews' coefficent 2.25 Rfactor 0.1513
    Waters 286 Solvent Content 45.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3r4i
    1. Structural insights into RipC, a putative citrate lyase subunit from a Yersinia pestis virulence operon
    R Torres, N Chim, B Sankaran, C Pujol - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary

    Target ID 397760 belongs to theHpcH_HpaI Pfam Family (PF03328). This family includes 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase and 4-hydroxy-2-oxovalerate aldolase, and is represented by 21 strructures in the PDB.

     

    Shown below is a ribbons representation of the structure of target ID 397760 color-coded with the N-terminal end in blue and the C-terminal end in red.

    monomer.png

     

     The structure of a homolog of this protein has been determined by JCSG.

     

    Shown below is the likely oligomeric state of target ID 397760, a trimer, with the individual chain color coded as green, blue, and  yellow.  Analytical size exclusion chromatography supports the assignment of a trimer as a likely oligomeric state in solution.

     

     

    trimer.png
     

     

     

    A DALI search of the PDB reveals that the following structures are similar to that of target ID 397760

    PDB ID DALI Z-score rmsd (Ang) length of alignment number residues % sequence id Description
    1sgj 28.9 1.7 221 231 21 Citrate Lyase Beta-subunit (NYSGXRC)
    1u5h 26.3 2.0 215 223 21 Citrate Lyase beta subunit from Mycobacterium tuberculosis
    3cv2 23.3 2.5 239 524 15 E. coli malate synthease A
    1p7t 23.1 2.4 235 706  11  E. coli malate synthase G: pyruvate:acetylCoA
    1n8w 22.6 2.4 239 718  12 Malate synthase from Mycobacterium tuberculosis
    3hqo 19.4 3.7 235 491 11  Leishmania mexicana pyruvate kinase (LmPYK) in complex with ATP and oxalate
                 
                 
                 
                 
                 

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     monomer.png
    No description
    155.82 kB18:58, 27 Jul 2010haxelrodActions
     trimer.png
    No description
    296.82 kB20:19, 8 Feb 2011haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch