.
The Open Protein Structure Annotation Network
PDB Keyword
.

3r4r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical fimbrial assembly protein (BDI_3522) from Parabacteroides distasonis ATCC 8503 at 2.38 A resolution. To be published
    Site JCSG
    PDB Id 3r4r Target Id 394815
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS25386,YP_001304845.1, 325960 Molecular Weight 32673.03 Da.
    Residues 295 Isoelectric Point 4.82
    Sequence evpigfdtdelsfdmslvlltgdmqtkasdpnytyatteeltiqnchvavfdkdgkriyfknfyskdlg emktignlsgyelqlegvrtfgkedkkvsvlvvanannannspfdnlttydgvdnsytaktiakgpvta sllvkigksettlkynqdnapvtvsliqlsakieytgvykkengellegfsltkvaglnasskitifnt savengafsdlaypttkpvtfytyeisdafkevilsvqsgvepkeypfpankfikgnyyrikglksste iewvlenvedkevtldpfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.38 Rfree 0.2449
    Matthews' coefficent 2.67 Rfactor 0.2256
    Waters 79 Solvent Content 53.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3r4r
    1. Homology modeling of class ag protein-coupled receptors.
    S Costanzi - Methods in molecular biology (Clifton, NJ), 2012 - Springer
     

    Protein Summary

    Topsan Update: This looks like a weak outlier to P_gingi_FimA (PF06321). This family already a traget for that I have come across elsewhere and has been written up for publication (I think).

     

    Structural analysis obtaine using Dali

         Chain   Z    rmsd lali nres  %id PDB  Description

    1:  3liu-A 15.3  3.1  235   372   15 PDB  MOLECULE: PUTATIVE CELL ADHESION PROTEIN;
    2:  3liu-B 15.2  3.1  233   373   16 PDB  MOLECULE: PUTATIVE CELL ADHESION PROTEIN;
    3:  3gf8-A 12.0  4.2  213   284   14 PDB  MOLECULE: PUTATIVE POLYSACCHARIDE BINDING PROTEINS (DUF1812
     

    Note that the 3gf8 hit was considered as a putative fimbrial assembly protein (Ref: 2010 Acta Crystallogr.,Sect.F 66: 1281-1286).
     

     

    Shown below is a ribbons representation of the structure of target id 394815 color-coded with the N-terminal end in blue and the C-terminal end in red.

    monomer.png

     

    Shown below is a comparison of the structures of target id 394814 (green) and PDB ID 3gf8 (cyan)

    3fg8_overlap.png

     

     

    Shown below is a comparison of the structures of target id 394814 (green) and PDB ID 3liu (magenta)

     

    3liu_overlap.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch