The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical TetR-like transcriptional regulator (Sama_0099) from SHEWANELLA AMAZONENSIS SB2B at 2.42 A resolution. To be published
    Site JCSG
    PDB Id 3rh2 Target Id 399142
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS30584,YP_925981.1, 323555 Molecular Weight 24705.10 Da.
    Residues 211 Isoelectric Point 6.07
    Sequence mktrdkiiqaslelfnehgertittnhiaahldispgnlyyhfrnkediircifdqyeqhlllgfkpya dqkvdlellmsyfdamfytmwqfrfmyanladilarddtlkarylkvqqavleqsiavlnqlkkdgilq iederiadladtikmiigfwisykltqssiatiskaslyegllrvlmifkaystpdslanfdrleqhfr sqsn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.42 Rfree 0.2496
    Matthews' coefficent 3.76 Rfactor 0.2047
    Waters 38 Solvent Content 67.31

    Ligand Information



    Protein Summary

    This is a TetR family transcriptional regulator with an unidentified ligand UNL (red spheres) at the putative ligand binding site.

    Pfam update: This is an interesting sequence because it starts with the last residue of family TetR_N, PF00440, and then extends to just before the first residue of TetR_C. (Possibly indicates that the boundaries for TetR_N are slightly out). So it is the active helix-turn-helix DNA-binding region of TetR, a family of bacterial transcriptional repressors. So this family has been built as TetR, PF13972. There is already one structure, 3nnr, in the family. https://pfamsvn.sanger.ac.uk/svn/pfa...ilies/PF13972/ It is possible with some tweaking that it can include a lot of related, eg BetI, repressors, too, and will work on that so the family may grow bigger.


    This target belongs to Pfam family PF00440. The JCSG has solved > 20 structures from this family including PDB accession codes: 3qkx, 3qbm, 3ppb, 3pas, 3nrg, 3npi, 3nnr, 3lwj, 3jsj, 3gzi, 3egq, 3dcf, 3cwr, 3cjd, 3bhq, 3b81, 2rha, 2ras, 2qtq, 2o7t, 2hyt, 1zkg.

    This target has 37% seq id to 3nnr (Topsan entry for 3nnr), which also has a bound UNL.

    Ligand Summary

    UNL at the putative ligand binding site.




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    412.21 kB19:13, 18 Mar 2011debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch