.
The Open Protein Structure Annotation Network
PDB Keyword
.

3s25

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical 7-bladed beta-propeller-like protein (EUBREC_1955, ERE_32420) from Eubacterium rectale at 1.88 A resolution. To be published
    Site JCSG
    PDB Id 3s25 Target Id 390003
    Molecular Characteristics
    Source Eubacterium rectale atcc 33656
    Alias Ids TPS7654,YP_002937831.1, 283193 Molecular Weight 34508.41 Da.
    Residues 301 Isoelectric Point 5.68
    Sequence lnssyvngntagnlynaglfcesdgevffsntndngrlyamnidgsnihklsndtamyinadknyvyyv rnnnqkitsqtffsydrnslcrikrnghgstvldpdpciyaslignyiyylhydtqtatslyriridge ekkkiknhylftcntsdryfyynnpkngqlyrydtasqsealfydcncykpvvlddtnvyymdvnrdna ivhvninnpnpvvlteaniehynvygslifyqrggdnpalcvvkndgtgfkelakgefcninvtsqyvy ftdfvsnkeyctstqnpdtikalqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.88 Rfree 0.1829
    Matthews' coefficent 2.73 Rfactor 0.1583
    Waters 172 Solvent Content 54.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein structure reveals a 7-bladed propeller in which each blade is comprised of ~40 residues. This is a secreted protein. The structure is similar to that of WD40/YVTN repeat-like domains, which usually have distinct sequences.

    Fig1.png

    Top structurally similar proteins as found by SSM are the beta-propeller domain of the P. furiosus trilobed protease (PDB id 2gop, Q-score 0.31, 3.3A rmsd, 9% sequence identity), the S. aureus virginiamycin B lyase (PDB id 2z2o, Q-score 0.28, 3.2A rmsd, 12% seq id), WDR5 (Q-score 0.27, 3.5A rmsd, 9% seq id).

    This protein is also similar in structure to TolB (~10-12% seq id to PDB ids 1c5k and 2ojh), which is involved in translocation.

    Proteins with WD repeats are involved in a wide variety of functions including enzyme function and scaffolding for forming protein-protein complexes and have been reviewed in several papers (PMID: 10322433, PMID: 8090199, PMID: 21468892).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    312.67 kB18:06, 6 Apr 2011debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch