.
The Open Protein Structure Annotation Network
PDB Keyword
.

3s30

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical glycoside hydrolase (BVU_0247) from Bacteroides vulgatus ATCC 8482 at 2.46 A resolution. To be published
    Site JCSG
    PDB Id 3s30 Target Id 393205
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS27813,YP_001297591.1, 324101 Molecular Weight 39237.61 Da.
    Residues 353 Isoelectric Point 4.88
    Sequence adilncilpaemltgtdidynrpydkslnaypiyievnngtdltrlaptfeltegasiepangstqnft npvrytvtsedknwhrtyainihypetksiptvfnfenvktvpynkneyyvlyeaasgystltwssgnq gfaltgsgytpndfptsispngrtgnclqlitrktgslgtlvgmpiaagnlfigsfdigsamsdalsat kfgttfyyepiklvgyykykagpefyengestnrkdvfniyalfyektkdvqmldghiaknnyehenmv aaavitdthetsewtrfeldfnyehygktidpqklanggynvsivlsaskdgdvfqgapgstlliddle lvckqplr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.46 Rfree 0.2506
    Matthews' coefficent 3.59 Rfactor 0.2325
    Waters 168 Solvent Content 65.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3s30
    1. HIV Protein Sequence Hotspots for Crosstalk with Host Hub Proteins
    M Sarmady, W Dampier, A Tozeren - PloS one, 2011 - dx.plos.org
     
    2. Sequence-and Interactome-Based Prediction of Viral Protein Hotspots Targeting Host Proteins: A Case Study for HIV Nef
    M Sarmady, W Dampier, A Tozeren - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Target GS13522A (ID 393205) shares about 42.4% sequence identity with the C-t subdomain of a putative Glycoside hydrolase (pdb 3HBZ), solved also by the JCSG. The structure of this protein has a jelly-roll fold (Galactose-binding domain-like according to SCOP, see Topsan for 3HBZ). HHpred analysis against Pfam indicated that target GS13522A belongs to Glyco_hydro_44 - family of putative bacterial glycoside hydrolases (PF12891, prob 100.0, E-val 0). As expected, the structural analysis also shows similarities with the putative Glycoside hydrolase (3HBZ) - FATCAT/DALI top hit PUTATIVE GLYCOSIDE HYDROLASE (Pdb 3hbzA, Z-score 25.4, rmsd 1.8, P-value 1.61e-10).       

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch