The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative transcriptional regulator of the TetR family (SYN_02108) from Syntrophus aciditrophicus SB at 2.60 A resolution. To be published
    Site JCSG
    PDB Id 3s5r Target Id 399109
    Molecular Characteristics
    Source Syntrophus aciditrophicus sb
    Alias Ids TPS30582,YP_461098.1, _0018.001261_, 327804 Molecular Weight 23829.36 Da.
    Residues 215 Isoelectric Point 5.04
    Sequence mqatmtdkntrellldaattlfaeqgiaattmaeiaasvgvnpamihyyfktrdslldtiieerigrii dmiwepvtgeeddplimvrdlvnrivntcetmlwlpslwireivneggalrekmlnnipidkmnkfsak iaegqkqgvinsgidsrlligsiigltmlplataklrdqiptmkglssedivchvtallftgltnpsns ddikkqrt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.2550
    Matthews' coefficent 2.66 Rfactor 0.2426
    Waters 7 Solvent Content 53.72

    Ligand Information



    Protein Summary

    Pfam update: "I have built a family from the C-terminal part and find that it binding, helix-turn-helix domain at the N-terminal, so this should prove interesting if the nature of the activity towards the C-terminus can be determined."

    This protein belongs to the TetR family fo transcriptional regulators.


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    No description
    408.2 kB00:21, 30 Mar 2011debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch