.
The Open Protein Structure Annotation Network
PDB Keyword
.

3sbu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical ntf2-like protein (BF2862) from Bacteroides fragilis NCTC 9343 at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 3sbu Target Id 393201
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS26589,YP_212476.1, 332455 Molecular Weight 30449.37 Da.
    Residues 260 Isoelectric Point 4.68
    Sequence adpfasithlvdsamvnktdsidrektsdepkpieadesfddfiynfasddalqrqrvvfplpyynger askidrkywkhddlfakqsyytllfdreedmdlvgdtsltsvqvewifvkkrmvkkyyferikgawmle ainlrpieenenedfveffghfatdsifqsrrirqplvfvttdpdddfsilettldlnqwfafkpalpa dklsninygqqnddnashkilalkgigngfsnilyfqrkdsgwelykfedtsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.1917
    Matthews' coefficent 2.94 Rfactor 0.1762
    Waters 158 Solvent Content 58.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    The structure consists of two similar domains. The function of the protein is unknown, it defines a new pfam family PF14254.

     

    Fig. 1. Structure of 393201  

    gs13510a.png

       

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     gs13510a.png
    GS13510B
    160.82 kB19:44, 17 May 2011qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch