.
The Open Protein Structure Annotation Network
PDB Keyword
.

3sc3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative DNA replication regulator Hda (Sama_1916) from SHEWANELLA AMAZONENSIS SB2B at 3.00 A resolution. To be published
    Site JCSG
    PDB Id 3sc3 Target Id 396931
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS24871,SAMA_14OCT04_CONTIG53_REVISED_GENE1514, _0000.000791_, 326256 Molecular Weight 25044.42 Da.
    Residues 224 Isoelectric Point 5.64
    Sequence vhlpddetftsyypaagndeligalksaasgdgvqaiylwgpvksgrthlihaacaranelerrsfyip lgihasistallegleqfdliciddvdavaghplweeaifdlynrvaeqkrgslivsasaspmeagfvl pdlvsrmhwgltyqlqpmmddeklaalqrraamrglqlpedvgrfllnrmardlrtlfdvldrldkasm vhqrkltipfvkemlrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.00 Rfree 0.2532
    Matthews' coefficent 3.50 Rfactor 0.2237
    Waters Solvent Content 64.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Belongs to Bac_DnaA family.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch