.
The Open Protein Structure Annotation Network
PDB Keyword
.

3sgg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical hydrolase (BT_2193) from Bacteroides thetaiotaomicron VPI-5482 at 1.25 A resolution. To be published
    Site JCSG
    PDB Id 3sgg Target Id 393069
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS20968,NP_811106.1, 325005, 325023 Molecular Weight 59459.63 Da.
    Residues 535 Isoelectric Point 4.95
    Sequence agvvvpkytpstenpggpgeepgdglidpaepldrgfmhlkgrelkslnsisitglndgekvilstlag laarvtgdqvyineggpssvwlkqmqnkygipvntynalaplvqhyvetgvikgyivytpysegqshsi nvatslcgllrgiavpeslvdkvkamgvttelmdvrsydekwlyenykdqldkslaadmkpeifhhlrd yitmtnafafydynarrdwswrtsilkdldkgaycfgyydldewgmvnnasqlgvsmlptdqaanlatl ssiydttglkqrpatkevvteenvhyvtflvsdgdniafnlwgqqgymdhdlhgqfplgytispslydl apaalrwyyenskegdyfvagpsgssyifpskmsdadlddylaklneyvdksglnicnildqkimdnpk vynkylaqpnidaifytgygekgdgrikfsdngkpvieqrsvlwegidggsnrgeestvisqinsrsan phsadgytfvfvhcwtknqqsiktvidglndnvrvvpvdqfvqlvkqnlgpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.25 Rfree 0.1764
    Matthews' coefficent 2.16 Rfactor 0.1508
    Waters 571 Solvent Content 43.06

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This structure helps identification of a new pfam family  PF14323. Sequence and structural similarity searches suggest a possible role of sugar processing. Three homologs in B. thetaiotamicron, BT2193 (this protein), BT2200, BT3857 and BT3859 (the first two may belong to an operon; the second pair is in an operon likely digesting α-mannan, host N-glycans--see 21507958).
     

    The structure consists of a TIM barrel which is most similar to Peptidoglycan Deacetylase (3qbu), however, this structure does not contain the zinc binding site. The N-terminal domain (47-302) consists of 3 similar subdomains made of ba repeats, reminiscient of b-propeller. The N-terminal domain does not have significant 3d structural matches.

     

    There are two versions of protein sequences, one like this structure, another one with circular permutation (near residues 200).

     

    Fig 1. monomer

    gs14058a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     gs14058a.png
    gs14058a
    189.76 kB18:04, 7 Jun 2011qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch