.
The Open Protein Structure Annotation Network
PDB Keyword
.

3sgh

    Title Crystal structure of a Hypothetical SusD-like protein (BT_3752) from Bacteroides thetaiotaomicron VPI-5482 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3sgh Target Id 390309
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS64809,NP_812663.1, 89016 Molecular Weight 55134.57 Da.
    Residues 498 Isoelectric Point 5.02
    Sequence fedfntnpyqpskvpasnllstmfnvyacpqqnacqeincmwasfsgqvtatanwsfgknifayynase ghndsswgrlygyiypsfflvenstekkgviyamaqltrvygmqllaslqgpipytqmkageteapydn eqtvwhamfddldnaitilksaatfgvnqdlavvdqfykgdcskwlkfantlklrmairisgvepeyaq tkaqeavlggvmesvgdssydttngginengyaivsgwpevranaclvsymngyndprrpayftpqtqt aaggyvgvrsgsaeipeptvyanysklfiatdktlpqpvmyaaeaaflraegalkgwnmggdaktfyek gvrlsfeefgvsgaddyladatsipgnyvdnliaghtgnnytnqssitikwedgaddakklervltqkw iacypdpmngwadfrrtgyprifpatesmnadcntgrgqrrlrftrseynnnkanveaavsmlsngkds ngtdlwwamkengty
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.1742
    Matthews' coefficent 2.17 Rfactor 0.1387
    Waters 1369 Solvent Content 43.37

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein NP_812483.1 is annotated as hypothetical protein BT3571. This is actually a Susd homolog with several structures in the PDB.

    GS7807J.png

     

    Top 10 DALI Structural Homologs
     
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3cgh 49.1 1.7 463 507 36 Susd Homolog
    2 3gzs 48.9 1.7 465 495 31 Uncharacterized Susd Superfamily Protein
    3 3ehm 44.5 2.0 461 510 27 Susd Homolog
    4 3ehn 44.0 2.1 461 514 27 Susd Homolog
    5 3p1u 38.1 2.4 438 515 28 Susd Homolog
    6 3ejn 34.1 2.7 408 450 24 Susd Homolog
    7 3mx3 33.4 2.9 419 469 20 Susd Homolog
    8 3fdh 31.0 3.1 404 472 23 Susd Homolog
    9 3mcx 22.8 3.2 361 459 16 Susd Superfamily Protein
    10 3kez 22.7 2.9 339 448 14 Putative Sugar Binding Protein

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     GS7807J.png
    No description
    146.48 kB16:57, 6 Jun 2011abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch