.
The Open Protein Structure Annotation Network
PDB Keyword
.

3so5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an Immunoglobulin I-set domain of Lrig3 protein (Lrig3) from MUS MUSCULUS at 1.70 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 3so5 Target Id 421320
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS66960,BC065142 Molecular Weight 12296.05 Da.
    Residues 111 Isoelectric Point 5.04
    Sequence gfvcddfpkpqitvqpetqsaikgsdvsftcsaasssdspmtfawkkdnealqdaemenyahlraqgge lmeyttilrlrnveftsegkyqcvisnhfgssysvkakltin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2162
    Matthews' coefficent 2.26 Rfactor 0.2058
    Waters 193 Solvent Content 45.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch