.
The Open Protein Structure Annotation Network
PDB Keyword
.

3son

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical NUDIX hydrolase (LMOf2365_2679) from LISTERIA MONOCYTOGENES (ATCC 19115) at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3son Target Id 376521
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS6949,YP_015267.1, 103523 Molecular Weight 17123.34 Da.
    Residues 148 Isoelectric Point 4.61
    Sequence mrqpfqvlvipfikteanyqfgvlhrtdadvwqfvagggedeeaisetakresieelnldvdvkmysld shasipnfhfsfnkpyvvpeycfaidltscsyqvtlslehselrwvsyesavqllewdsnktalyelne rlknndmkam
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.71 Rfree 0.1960
    Matthews' coefficent 2.27 Rfactor 0.1634
    Waters 170 Solvent Content 45.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3son
    1. Computational Studies of Novel Chymase Inhibitors against Cardiovascular and Allergic Diseases: Mechanism and Inhibition
    M Arooj, S Thangapandian, S John - Chemical Biology & , 2012 - Wiley Online Library
     

    Protein Summary

    protomer.png

     

    protomer

     

     protomer.png

    dimer

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     dimer.png
    dimer structure of MutT/nudix family protein from Listeria monocytogenes
    200.28 kB15:41, 24 Jun 2011mmillerActions
     protomer.png
    protomer structure of MutT/nudix family protein from Listeria monocytogenes
    134.6 kB15:41, 24 Jun 2011mmillerActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch