.
The Open Protein Structure Annotation Network
PDB Keyword
.

3td9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Leucine binding protein LivK (TM1135) from Thermotoga maritima MSB8 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3td9 Target Id 420134
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS66841,TM1135 Molecular Weight 40127.93 Da.
    Residues 370 Isoelectric Point 5.27
    Sequence mrkvlvtvllvltvlslfsavkiavilpmtggisafgrmvwegiqiaheekptvlgeevelvlldtrse kteaanaaaraidkekvlaiigevasahslaiapiaeenkvpmvtpastnplvtqgrkfvsrvcfidpf qgaamavfayknlgakrvvvftdveqdysvglsnffinkftelggqvkrvffrsgdqdfsaqlsvamsf npdaiyitgyypeialisrqarqlgftgyilagdgadapelieiggeavegllftthyhpkaasnpvak kfvevykekygkepaalnalgydaymvlldaieragsfdrekiaeeirktrnfngasgiinidengdai ksvvvnivkngsvdfeavinpddlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.1925
    Matthews' coefficent 2.22 Rfactor 0.1508
    Waters 262 Solvent Content 44.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3td9
    1. Characterization of transport proteins for aromatic compounds derived from lignin: benzoate derivative binding proteins
    K Michalska, C Chang, JC Mack, S Zerbs - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch