.
The Open Protein Structure Annotation Network
PDB Keyword
.

3tdq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a fimbrial biogenesis protein PilY2 (PA4555) from Pseudomonas aeruginosa PAO1 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 3tdq Target Id 417321
    Molecular Characteristics
    Source Pseudomonas aeruginosa pao1
    Alias Ids TPS47452,NP_253245.1, 324543 Molecular Weight 11076.83 Da.
    Residues 97 Isoelectric Point 4.68
    Sequence edpqtfegagvvfevqveknlvdidhrlyrlpnstvrngmpslfqvkpgsvvsysgtvsqpwstitdiy ihkqmseqelaemiekeqprqdgeeqpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2150
    Matthews' coefficent 2.33 Rfactor 0.1868
    Waters 104 Solvent Content 47.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    PilY2 is a representative of a small (~8 members), Psedomonas specific protein family, not classified in PFAM. Shown to be involved in fimbrial biogenesis, but its exact role appears to be unknown (see PCMID 8899718 - why the insert reference widget is not working?). Marginal similarity to cation efflux system protein cusF (2qcp, PFAM family PF11604), but also to DUF1344 (PF07076) is seen by FFAS. New PFAM clan? Does copper (?) binding play a role in fimbrial biogenesis? Might be interesting.

     

    This structure is similar to copper binding protein CusF, but lost the copper binding site.

     

    Fig. 1. dimer

    sp18898a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     sp18898a.png
    SP18898A
    113.84 kB16:54, 5 Aug 2011qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch