.
The Open Protein Structure Annotation Network
PDB Keyword
.

3tx8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate desuccinylase from Corynebacterium glutamicum. Acta Crystallogr.,Sect.D 68 391-403 2012
    Site JCSG
    PDB Id 3tx8 Target Id 376512
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS6944,NP_600337.1, 3.40.630.10 Molecular Weight 39972.01 Da.
    Residues 369 Isoelectric Point 4.84
    Sequence mnselkpgldllgdpivltqrlvdipspsgqekqiadeiedalrnlnlpgvevfrfnnnvlartnrgla srvmlaghidtvpiadnlpsrvedgimygcgtvdmksglavylhtfatlatstelkhdltliayeceev adhlnglghirdehpewlaadlallgeptggwieagcqgnlrikvtahgvrahsarswlgdnamhklsp iiskvaaykaaevnidgltyreglnivfcesgvannvipdlawmnlnfrfapnrdlneaiehvvetlel dgqdgiewavedgaggalpglgqqvtsglidavgrekirakfgwtdvsrfsamgipalnfgagdpsfah krdeqcpveqitdvaailkqylse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.97 Rfree 0.2566
    Matthews' coefficent 4.47 Rfactor 0.2379
    Waters Solvent Content 72.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3tx8
    1. Application of DEN refinement and automated model building to a difficult case of molecular-replacement phasing: the structure of a putative succinyl-diaminopimelate
    AT Brunger, D Das, AM Deacon, J Grant - Section D: Biological , 2012 - scripts.iucr.org
     
    2. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of succinyl-diaminopimelate desuccinylase (Rv1202, DapE) from
    L Reinhard, J Mueller-Dieckmann - Section F: Structural , 2012 - scripts.iucr.org
     
    3. Improved crystallographic models through iterated local density-guided model deformation and reciprocal-space refinement
    TC Terwilliger, RJ Read, PD Adams - Section D: Biological , 2012 - scripts.iucr.org
     

    Protein Summary

    This is a putative metallopeptidase and part of the zinc peptidase set of structures being solved. Additional information on these proteins can be found on the Topsan Zinc Peptidase site tagged below.

    Pfam update: This protein is in family Peptidase_M20 (PF01546),

    THE STRUCTURE WAS SOLVED BY A COMBINATION
    OF MOLECULAR REPLACEMENT USING PHASER AND DEN REFINEMENT IN CNS,
    IN CONJUCTION WITH MODELLER, AUTOBUILD AND EXPERIMENTAL PHASING
    WITH SE MAD PHASES.THE REFINEMENT WAS RESTRAINED WITH THE MAD PHASES.

    A manuscript describing the structure determination and structure has been submitted.
     

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    270.83 kB22:28, 13 Sep 2011debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch