.
The Open Protein Structure Annotation Network
PDB Keyword
.

3tzg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein BVU_2266 (BVU_2266) from Bacteroides vulgatus ATCC 8482 at 2.80 A resolution. To be published
    Site JCSG
    PDB Id 3tzg Target Id 393238
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS66317,YP_001299547.1, 332469 Molecular Weight 29099.17 Da.
    Residues 251 Isoelectric Point 5.52
    Sequence kekkadtyvtkvtdltgeeeqvlkleydrdgkiikygdtpvryegdqitigqmnclntgnklcnvtfqi gkgkaresrarcmlkvgeevyeadkqtvydykgdtifinsdyratsdyrflkkvqgkyvfdqlgrlkev mtvfteandsvsschtyynydnninyqanlnlqayvidydgvdsffyfllnlgqlrnrtalpndigycm nhglstynvhanyrlddenpvrievlynytkllsridlsynpln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.2410
    Matthews' coefficent 2.67 Rfactor 0.1966
    Waters 68 Solvent Content 54.02

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    A porin-like solubile protein with unknown function. Only a couple of highly similar sequences, an orphan at this point. There are few more homologs in human metagenomics samples, but the most divergent protein has ~70% sequence identity.

     

    Fig. 1 Monomer

    gs13697a-v2.pnggs13697a-v1.png

     

    We (and others) solves several such soluble beta-barrel, porin-line structures, for instance our 2o62 and Midwest 1tlx. SCOP has been classifying them as lipocalin-like fold (b.60) and while most of them have no known function, some have been shown to bind small molecules inside the barrel and probably function as detoxificants/transporters. Interestingly, these proteins look like half of BVU_2266 (our protein)- see below.

    1.png2.png

     

    side and top view of the BVU_2266 (red) and 2o62 (green) structural alignment. Note that the connectivity of the side beta sheet is identical, so one domain of 2o62 (which is a two domain protein) looks essentially like half of BVU_2266, but the inside of the beta barrel is blocked (in the X-ray structure) by the two helix cap. Could it be a removable "plug"?

     

    Also, BVU_2266 sort of looks like built from four 4-strand segments (3 segments, two helices, 1 segment, segment boundaries 29-68, 69-124, 124-179, 220-270).3.png

     

    Could be just an effect of regularity of a beta sheet. I dont know. I dont see any traces of this modularity on the sequence level. 

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (5)

    FileSizeDateAttached by 
     1.png
    structural alignment with 2o62 - side
    155.8 kB03:12, 26 Sep 2011adamActions
     2.png
    structural alignment with 2o62 - side
    141.41 kB03:12, 26 Sep 2011adamActions
     3.png
    4-strand segments
    110.83 kB04:09, 26 Sep 2011adamActions
     gs13697a-v1.png
    GS13697A-1
    111.04 kB18:39, 19 Sep 2011qxuActions
     gs13697a-v2.png
    GS13697A-2
    103.87 kB18:39, 19 Sep 2011qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch