.
The Open Protein Structure Annotation Network
PDB Keyword
.

3u21

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Novel Winged-Helix Like Domain from Human NFRKB Protein. Plos One 7 e43761-e43761 2012
    Site JCSG Biology Target:
    PDB Id 3u21 Target Id 421522
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS66980,BC063280 Molecular Weight 14229.19 Da.
    Residues 126 Isoelectric Point 4.28
    Sequence lgineisssffsllleilllesqaslpmleervldwqsspasslnswfsaapnwaelvlpalqylages ravpssfspfvefkektqqwkllgqsqdnekelaalfqlwletkdqafckqenedss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.18 Rfree 0.2695
    Matthews' coefficent 2.09 Rfactor 0.2305
    Waters 25 Solvent Content 41.26

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch