.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ucg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a RNA binding domain of Hypothetical POLYADENYLATE-BINDING PROTEIN (PABPN1) from Homo sapiens at 1.95 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 3ucg Target Id 422572
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67040,BC010939 Molecular Weight 9774.50 Da.
    Residues 88 Isoelectric Point 6.82
    Sequence meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldes lfrgrqikvipkrtnrpgi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.2096
    Matthews' coefficent 3.35 Rfactor 0.1629
    Waters 57 Solvent Content 63.31

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    The RNA binding domain of human POLYADENYLATE-BINDING PROTEIN, PABP-2 or PABII. A classical RRM domain, covered by PFAM RRM_1 family.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch