.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ufi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein BACOVA_04980(ZP_02067969.1) from Bacteroides ovatus ATCC 8483 at 2.18 A resolution. To be published
    Site JCSG
    PDB Id 3ufi Target Id 417106
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS62778,ZP_02067969.1, 164, 332529 Molecular Weight 32385.15 Da.
    Residues 296 Isoelectric Point 4.43
    Sequence deesgkadraykpieiygninevvnnvqetravgaawgsddrigvtveadednatanavdtyiniqyrn etggsfrvvnegstdnnirlkgegeftlnayypyqgangtlpgtegviaktisgadqttdkqpqidflf aqatgvraespvtfdfshkmtkiilkfkatngatlnnmkvylkslqlegsfnvttgeavaksgatpnse lsmdiakpaegemtasiilfpqdmpekvllevrmndetytqympvqnlesghaypynvtfenpamtitk aeiedwiveddkdvtasvte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.18 Rfree 0.2019
    Matthews' coefficent 6.93 Rfactor 0.1776
    Waters 331 Solvent Content 82.24

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Similar to 3sy6 and 3t2l, belongs to the FimA superfamily.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch