.
The Open Protein Structure Annotation Network
PDB Keyword
.

3us4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SH2 domain of a megakaryocyte-associated tyrosine kinase (MATK) from Homo sapiens at 1.50 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 3us4 Target Id 423006
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67104,NM_139355 Molecular Weight 11178.40 Da.
    Residues 97 Isoelectric Point 7.95
    Sequence lslmpwfhgkisgqeavqqlqppedglflvresarhpgdyvlcvsfgrdvihyrvlhrdghltideavf fcnlmdmvehyskdkgaictklvrpkrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2081
    Matthews' coefficent 2.08 Rfactor 0.1855
    Waters 72 Solvent Content 40.85

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch