.
The Open Protein Structure Annotation Network
PDB Keyword
.

3uwt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution. To be published
    Site JCSG Biology Target:
    PDB Id 3uwt Target Id 422547
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67030,BC008875 Molecular Weight 21867.80 Da.
    Residues 199 Isoelectric Point 6.36
    Sequence aaqrqralaimcrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfafveyevpeaaqla leqmnsvmlggrnikvgrpsnigqaqpiidqlaeearafnriyvasvhqdlsdddiksvfeafgkiksc tlardpttgkhkgygfieyekaqssqdavssmnlfdlggqylrvgkavtppmplltpatpg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2399
    Matthews' coefficent 2.14 Rfactor 0.2025
    Waters 27 Solvent Content 42.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3uwt
    1. A Broad Range of Conformations Contribute to the Solution Ensemble of the Essential Splicing Factor U2AF65
    JL Jenkins, KM Laird, CL Kielkopf - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    The structure of the first two RRM domains (residues 101-299 from the human poly-U binding splicing factor (60KDa, PUF60). These are "classical" RRM domains, covered by the PFAM RRM_1 family Pfam PF00076 RRM_1)

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch