The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 400674
    Molecular Characteristics
    Source Desulfitobacterium hafniense dcb-2
    Alias Ids TPS29774,DHAF_12NOV03_CONTIG979_REVISED_GENE4677, _0032.000316_, _0106.000668_, 332730 Molecular Weight 41293.24 Da.
    Residues 367 Isoelectric Point 4.96
    Sequence mkiycskdslitgvntvqkavsnkntlpvlqgimiraegqslifeatdleigircvvpaqvekegvvvl psrlfsdlvrklpdvlielelqndvinihynesdlslrgydpeefpllpdlfdaetfnlpvsifktmik qtifacsaeesrpvftgcllqiedgslrliatdthrlayriaeisnpeqikfqgiipaktlgeiyrllr dedenlfirfnqaqivfqfgavhllsrliegqfpnykqvipqscqtkvllsarlfqdsverasllardg shtsiiklsvdterlsidqtselgkiseqmevkkegndvkiafnskflldvlkiidseeivfelsgsys pgiirpvddpnylylalpvrts
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch