The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 401075
    Molecular Characteristics
    Source Agrobacterium vitis s4
    Alias Ids TPS29780,YP_002547753.1, BIG_68, 332816 Molecular Weight 36406.58 Da.
    Residues 320 Isoelectric Point 5.41
    Sequence mttvlpldparytphllhsaermwpetncyvdlwievlcvlglppeamlgftltqdfegdqftffkvpl edlealygirvtelaifdraeahvaqqisrgrlclvemdsyfmpdtagvgyrqhhgkttvgvnrldlag rsmdyfhnggffrleaedfdgiwqlaapetapflpytefakfpetrpdethlravakrlfafhfarrpq gnpfagfaevfpaqveaiaerpfgyfhtyafntlrqfganfellashlkwlaaddrytneiaealrise laktvqfqlaravtrkkfdplkaaldpaidawdrlmtgladkma
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch