.
The Open Protein Structure Annotation Network
PDB Keyword
.

402582

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 402582
    Molecular Characteristics
    Source Chromobacterium violaceum atcc 12472
    Alias Ids TPS30746,NP_901202.1, _0021.001260_, _0004.000710_, _0018.000681_, 322449 Molecular Weight 42458.77 Da.
    Residues 372 Isoelectric Point 5.40
    Sequence mgimsdlasaqllqasaaqlpvytyfdpafyakeqallfadapqyyghelmapnagdyhtlewmghgkm lknvdgeiklisnvcrhrqaiiykgrgngnhivcnlhgwtydaggklvgaphfpetpclnlgqteltrw ngllfdarrdvaadlatlgvakhmsfdgyafhsthsadydfnwktfievysedyhvdpfhpglgnfvdc gdlkwewgdsyhvqtvgvknrlaragskvygkwheevrrryaeqqpefgaiwltyypnimvewyphvlv vsvviprgpekctvitefyypedvvwfepefieaeqaayfetakeddeicirmhegrkalwmagvsevg pyqspteegmqhfheyyrrlmgsalag
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch