The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 402692
    Molecular Characteristics
    Source Colwellia psychrerythraea 34h
    Alias Ids TPS30751,YP_266981.1, _0018.007245_, _0118.000557_, _0019.001207_, 322205 Molecular Weight 25464.72 Da.
    Residues 218 Isoelectric Point 5.54
    Sequence mktrdkiiqasielfneqgernvttnhiaahlaispgnlyyhfrnkediilsiyeeyarsllletlpkv ssevkpldslilymdsvfqttmkfrffysnlpvlldknpilrekyvevqqsiservsqllislraadyi dfnddeladivsilrlintfwvsfhqtqtivnevndsvfyqgvlkilvilrpytkahaiselnhardvy qqryreeaeta
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch