.
The Open Protein Structure Annotation Network
PDB Keyword
.

403031

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 403031
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS30769,YP_137067.1, 2.30.110.10, 322421 Molecular Weight 16543.04 Da.
    Residues 150 Isoelectric Point 3.91
    Sequence mdsdiafaytegmpddivrdrlgesesgvlaladgddayafpvfhhyedgslyfrlgetsgseksaylv atetatyvvteteqtpdaeawtgwsivargpiaavpdgdpayeaveineryapirvfdeptdemditly elsieeltgrqn
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch