.
The Open Protein Structure Annotation Network
PDB Keyword
.

403146

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 403146
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS30643,YP_096176.1, _0052.000186_, 324333 Molecular Weight 32330.45 Da.
    Residues 281 Isoelectric Point 8.41
    Sequence mkyqqklrnmidfigkhldeelsleslseifciskfhfhrlftaftglslqqyikwlrlkraahqlivd kdqsviniainagfesheafsrafkkacgfspsqfrqgfgrsyweqppyclpgqsrtdmkvdiksidki rlaviehkgdpkllgesinklvswaksqsinlkprageafalayddpkttppsdfridlgikvpenlkl dgviekflpsgryavtvhkgsrnnigdvvyylyrdwlpntseqlgdlpcifcyynfdhevaetelltec wlllk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch