The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 403234
    Molecular Characteristics
    Source Marinobacter aquaeolei vt8
    Alias Ids TPS30653,YP_957774.1, _0057.000943_, 370908 Molecular Weight 29865.65 Da.
    Residues 270 Isoelectric Point 6.19
    Sequence matphaefqqpselqgrrvlicrpepeasrlaeafrkagadarvmpmmareplpetpeqrgilqqldnf shiiavspyaarrlmeeidhwwpqlpaglqwygvgagtaavfrehglkprmpaegwtseallalpslqr vdgekvllargehgreliretlaqrgarittlplyrrvlpyysakqvkalvadfhpevvialsgetlnn lvelghryqlaltpdiivvpaervaeqaralgfrkplvpgslndddlvisvasclsqeagdng
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch