.
The Open Protein Structure Annotation Network
PDB Keyword
.

403366

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 403366
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS31016,NP_789923.1, _0014.003584_, _0076.003168_, 322613 Molecular Weight 51332.04 Da.
    Residues 465 Isoelectric Point 5.83
    Sequence mtevahvndshhappvirqlleklaisynevmddkslpparkvqavlvedavgallilfpqsqlldlsr iteltgrqltavphdrlarmltkhslqvlpglpaltsspclyddrllqeptllvgsgeagllleissdd fkgmlskasaahfgqsvaaihpnldrpdddpaeitqamraftarriqqrleatleipplagtaqkiikl rvdpdatidditgvvetdpalaaqvvswaaspyyastgkirsvedaivrvlgfdlvinlalglalgktl slpkdqpqqttpywqqsiytaaviegltraiprakrpegglsylagllhnfgylllahvfpphftlicr qlevnphlhhsyiehhllgisreqigawlmrywdmpdelstalrfqhdphyagehyayanlvylavrll rangvgagpeqeipdelfdrlglsrekanesvkkvleaevllrelasqfsk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch