.
The Open Protein Structure Annotation Network
PDB Keyword
.

403378

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 403378
    Molecular Characteristics
    Source Rhodobacter sphaeroides 2.4.1
    Alias Ids TPS30656,YP_353453.1, _0061.003249_, 324308 Molecular Weight 49888.88 Da.
    Residues 451 Isoelectric Point 4.81
    Sequence msdwtdrlpeaarayiadrrvdevecilsdiagvargkampafkfgkqtsfflpnsiflqtitgewadn psgaftepdmilipdystataapwtaditlqvihdavdqqgrpvpvsprnvlrrvvelynaegwtpiva pemefflvarnidpnmpvmppmgrtgrraaakqaysmsavdeygkviddiydfaeaqgfeidgilqegg agqveinlahgdpvaladqifffkrlireaalrhdcfatfmakpiegepgsamhihhsvvdsasklnif sdakggeteaflhfiagmqthlpaavallapyvnsyrryvpdfaapinlewgrdnrttglrvpisgpea rrlenrlagmdcnpylglaaslacgylglkerkmpqpectgdaymsetdlpynlgdaldlleedaalrd vlgpefcgvydsvkrneykeflqvispwerehlllnv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch