The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 406012
    Molecular Characteristics
    Source Geobacter metallireducens gs-15
    Alias Ids TPS31048,YP_383146.1, PF00877, 322739 Molecular Weight 30741.51 Da.
    Residues 276 Isoelectric Point 9.84
    Sequence gdaqhyavaelptpvlntpdfprvfggqdgrtvktdhqgqirelefialpgaaftvqetlrrggsvvhr vttddypyptttgyfvdarfvrltdetphprarklpsrnkiitrllaargsryvwggnvragvpdmirl fppagklsaeterrwllqgldcsgllyeatdgvtprntsalagygrgvpiaglsteeirqqlepldliv wkghviivldrertiesrlgpvpgkrdgvavrplrdvlsevmgkrvpvdrfaekngrgektfvvrrwyp
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch