The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 406239
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS30797,YP_001297593.1, 325583 Molecular Weight 38256.13 Da.
    Residues 355 Isoelectric Point 4.55
    Sequence ltyngapmpgkkvtftpdatnaqkatlrlegefdlngilgkaksaaaredvsmptapgvlpgspvvtlp vdltingdqcsfagtsetdyctfsykgevsagamelalsevklknaklagmtwklkpynqeveeqdpvr lvwesekgiplfgsfempvesvlkialrmpliavgaenkvsatdmlgtvlkdvtfmedgnivatykdaa nggtewtkspvnlaqyvvendnqikvflnpaaiiaavnnagraidvqtviqqaiqilypmlvngvpvaf eqtedalsvylntelllpllktlvvpllsdeevvamlvelmkkdpdfgemaglaepmlkafpeiiestt kveiglnfvk
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch