.
The Open Protein Structure Annotation Network
PDB Keyword
.

416539

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 416539
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS45725,NP_388106.1 Molecular Weight 30091.15 Da.
    Residues 279 Isoelectric Point 8.25
    Sequence aenpqtsvsntgkeadatknqtskadqvsapyegtgktskslyggqtelekniqtlqpssiigtdertr issttsfpyratvqlsikypntsstygctgflvnpntvvtaghcvysqdhgwastitaapgrngssypy gtysgtmfysvkgwteskdtnydygaiklngspgntvgwygyrttnssspvglsssvtgfpcdktfgtm wsdtkpirsaetykltyttdtygcqsgspvyrnysdtgqtaiaihtnggssynlgtrvtndvfnniqywanq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch