The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 416618
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS72068,YP_213611.1, 430342 Molecular Weight 65867.81 Da.
    Residues 579 Isoelectric Point 6.66
    Sequence qqgvtqcgtptgqapfpiqsykelpdpvapsekewaavkapqvqwgntdtryakhavpviqsqksitle gwrgeklhaqavvwtgtdlkglnyslsefknskgdvlpadafsggfvryvmtdelnkdgrggcgyrpdh siydsllvadpidhlltsmpmeakstqaiwincqvpqtvspgvyrgtvevkdgdnrlstlkmdikvssr vlpapsqwafhldlwqspfavaryyqvplwsqahidamrpvmkmladagqkiitasimhkpwngqtydy fesmvtwtkkvngtwafdydvfdkwvemmmsvgidkqincysmvpwklsfqyfdqatnsmqyvktapge kayeemwvamlksfskhlrekgwfdictiamderpmevmqktlqvirkadpefkvslagnfhkeleadi ydycipigasypaevlarraqnnlpttyytccteafpntftfsdpaeaawmsyysakdhldgylrwayn swpkeplldsrfeawaggdtylvypgarssirfekliegvqahekitilrkeftdkknktgfkklekml stfnlrdfpevpaaetvnkankilnsl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch