.
The Open Protein Structure Annotation Network
PDB Keyword
.

417432

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 417432
    Molecular Characteristics
    Source Ruminococcus gnavus atcc 29149
    Alias Ids TPS45771,ZP_02042336.1, 324525 Molecular Weight 10841.60 Da.
    Residues 93 Isoelectric Point 4.85
    Sequence enrqnmelrssgddnshwfhlsgvvvektfdtllielnekeesslffdttkvsldctkckgdleqvseg nvikfyffkynidgetvkierivr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch