The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 417469
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS73640,NP_372534.1, 328252 Molecular Weight 18116.04 Da.
    Residues 162 Isoelectric Point 8.02
    Sequence hsssnynginnvakaeqttdnalwknvrdalkdaniidktdnenvkvtykienggentiegtanlenis tsnnpkinpqnvtkinitrknsnypnidanntwkklteklkeknivnngdnvsilstdpkdetvfgkvg edksnvsnryinpkdineiqitkk
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch