.
The Open Protein Structure Annotation Network
PDB Keyword
.

417719

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 417719
    Molecular Characteristics
    Source Bacteroides eggerthii dsm 20697
    Alias Ids TPS76825,ZP_03458979.1, 324688 Molecular Weight 19745.27 Da.
    Residues 183 Isoelectric Point 6.94
    Sequence qdakesevrkvdafssieitsvgtihftqsdtysfriegrekyvkntettvkdgrlligfkdkknksrr nqkdgvtiwisapdlkeveftgvgefncekplkldevsfevkgvgevnvadltcnvlkvalrgvgsadi hvvcdylsaqmggvgsvtlsgsagradiskggiggvntdnlkigr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    Shown here is a ribbons representation of the structure of target id 417719 color coded with the N-terminal end in blue and the C-terminal end in red.

    monomer.png

    Target id 417719 is a member of the 6_harpin CL0059 Pfam clan. Members of this clan are annotated as a six-hairpin glycosidase superfamily. CL0059 contains 28 Pfam family. Target id 417719; however, is a member of the DUF2807 Pfam family. The structure of target id 417719 shows a Single-strabded right handed beta-helix fold with superhelix turns made of parallel beta-strands and turns, The target can most likely be classified into the Pectin-lyase-like Superfamily. A DALI search of the PDB shows that the structure of target id 417719 shows similarity to numerous entries. The table below show some of the top-scoring DALI hits.

     

    PDB ID Z-Score rmsd (Angstroms) length of alignment number of residues in target sequence identity (%0 Description
    3pet 24.3 1.4 167 218 29 Crystal structure of a putative adhesin (BF0245) from Bacteroides fragilis NCTC 9343 at 2.07 A resolution (JCSG structure)
    3lyc 22.3 1.7 169 237 23 Crystal structure of Putative pectinase (YP_001304412.1) from Parabacteroides distasonis ATCC 8503 at 2.30 A resolution (JCSG structure).
    3jx8 21.7 1.7 169 247 22 Crystal structure of Putative lipid binding protein (YP_001304415.1) from Parabacteroides distasonis ATCC 8503 at 2.16 A resolution (JCSG structure).
    3ljy 21.7 1.6 169 239 22 Crystal structure of putative adhesin (YP_001304413.1) from Parabacteroides distasonis ATCC 8503 at 2.41 A resolution (JCSG structure)
    4opw 21.1 1.8 169 241 22 Crystal structure of a putative adhesin (PARMER_02777) from Parabacteroides merdae ATCC 43184 at 1.75 A resolution (JCSG structure)
    4qrk 10.4 3.0 139 212 17 Crystal structure of a hypothetical protein (CLOSPO_03726) from Clostridium sporogenes ATCC 15579 at 1.95 A resolution (JCSG structure)
    2wlf 9.3 10.6 114 211 11 CRYSTALLOGRAPHIC ANALYSIS OF THE POLYSIALIC ACID O-ACETYLTRANSFERASE OATWY[Ref]
    2inv 8.5 3.2 126 399 10 Crystal structure of insulin fructotransferase in the presence of di-fructose [Ref]
    1ee6 8.2 2.7 117 197 9 CRYSTAL STRUCTURE OF PECTATE LYASE FROM BACILLUS SP. STRAIN KSM-P15.[Ref]

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    3. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     monomer.png
    No description
    138.81 kB19:41, 18 Aug 2014haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch