.
The Open Protein Structure Annotation Network
PDB Keyword
.

418471

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 418471
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS93425,YP_001337146.1, 326563 Molecular Weight 8602.39 Da.
    Residues 76 Isoelectric Point 4.92
    Sequence veettpqnmtcqefmdmnpksmtpvafwvvnrntdfsggdyvdwhevetvsvpkmlqechknpaaklgd lsavikk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch