The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 418694
    Molecular Characteristics
    Source Legionella pneumophila subsp. pneumophila str. philadelphia 1
    Alias Ids TPS73676,YP_095385.1 Molecular Weight 39763.39 Da.
    Residues 358 Isoelectric Point 5.20
    Sequence delvgfaafengdyttayphlmqaakegneeamyllgrmyqygygvttnyeearnwyqkaadknnalaq lslgfmydtgkgvsqdfteafkwymkaaeqgnpiaqrniglmyatgdgvaasddkafnwfkkaaeqgys kaqvnlgyqymmgkgtpkdvkkafewyqkaaeqgdekgeyslgllytgqeggigaddkaafywfsqaan hghvnaqtylayyylkgygvdadpvkaaywyqsaaekgqpeaqaqlgqllltgtgvdkdyqqaaywfgk sahqgnpigqaklgymylaglgvnkslvkayawlkiaaenkneeaakqlksleakltepekleaekmik dlgpleskenyed
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch