.
The Open Protein Structure Annotation Network
PDB Keyword
.

420695

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 420695
    Molecular Characteristics
    Source Eubacterium siraeum dsm 15702
    Alias Ids TPS77768,ZP_02423572.1 Molecular Weight 9196.60 Da.
    Residues 82 Isoelectric Point 5.27
    Sequence nfligswetsdglrrytfdentltvsskinsysklygysykgntlalqdsgntkyytvtikgseiviss adsdspeilhrve
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch