The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Diffraction-quality Crystals
    Target Id 421162
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS72268,BC004531 Molecular Weight 51153.77 Da.
    Residues 463 Isoelectric Point 5.49
    Sequence matvtattkvpeirdvtrierigahshirglglddaleprqasqgmvgqlaarraagvvlemiregkia gravliagqpgtgktaiamgmaqalgpdtpftaiagseifslemsktealtqafrrsigvrikeeteii egevveiqidrpatgtgskvgkltlkttemetiydlgtkmiesltkdkvqagdvitidkatgkisklgr sftrardydamgsqtkfvqcpdgelqkrkevvhtvslheidvinsrtqgflalfsgdtgeiksevreqi nakvaewreegkaeiipgvlfidevhmldiesfsflnralesdmapvlimatnrgitrirgtsyqsphg ipidlldrllivsttpysekdtkqilrirceeedvemsedaytvltrigletslryaiqlitaaslvcr krkgtevqvddikrvyslfldesrstqymkeyqdaflfnelkgetmdts
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch