.
The Open Protein Structure Annotation Network
PDB Keyword
.

421175

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Diffraction-quality Crystals
    Target Id 421175
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS66950,BC017355 Molecular Weight 57807.84 Da.
    Residues 521 Isoelectric Point 4.80
    Sequence maenpslenhriksfknkgrdvetmrrhrnevtvelrknkrdehllkkrnvpqeesledsdvdadfkaq nvtleailqnatsdnpvvqlsavqaarkllssdrnppiddliksgilpilvkclerddnpslqfeaawa ltniasgtsaqtqavvqsnavplflrllrsphqnvceqavwalgniigdgpqcrdyvislgvvkpllsf ispsipitflrnvtwvivnlcrnkdppppmetvqeilpalcvliyhtdinilvdtvwalsyltdggneq iqmvidsgvvpflvpllshqevkvqtaalravgnivtgtdeqtqvvlncdvlshfpnllshpkekinke avwflsnitagnqqqvqavidaglipmiihqlakgdfgtqkeaawaisnltisgrkdqveylvqqnvip pfcnllsvkdsqvvqvvldglknilimagdeastiaeiieecgglekievlqqhenediyklafeiidq yfsgddidedpclipeatqggtynfdptanlqtkefnf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch