The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Crystallized
    Target Id 421529
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS73446,BC051458 Molecular Weight 23665.56 Da.
    Residues 211 Isoelectric Point 4.64
    Sequence pcvttalgddipdlglnsadpdlpifvstnehelfqeaenalemlddfdfdrlldatsdgsplsesgge ngntthptfpsqvvpkvvptlpeglpvllekriedlrvaaklfdeegrkkfftqdmnnilldielqlqe lgpvirsgvyshleafvpcnketlvkrlkklhlnvqddrlreplqklklavsnvmpeqlfkyqedcqar sqak
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch