The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Diffraction-quality Crystals
    Target Id 421828
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS72278,NM_000662 Molecular Weight 33897.00 Da.
    Residues 290 Isoelectric Point 6.09
    Sequence mdieaylerigykksrnkldletltdilqhqiravpfenlnihcgdamdlgleaifdqvvrrnrggwcl qvnhllywalttigfettmlggyvystpakkystgmihlllqvtidgrnyivdagfgrsyqmwqpleli sgkdqpqvpcvfrlteengfwyldqirreqyipneeflhsdlledskyrkiysftlkprtiedfesmnt ylqtspssvftsksfcslqtpdgvhclvgftlthrrfnykdntdliefktlseeeiekvlknifnislq rklvpkhgdrffti
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch