.
The Open Protein Structure Annotation Network
PDB Keyword
.

422543

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Crystallized
    Target Id 422543
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67028,BC008451 Molecular Weight 10401.24 Da.
    Residues 93 Isoelectric Point 4.81
    Sequence mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaaidnmne selfgrtirvnlakpmrikegssr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch