.
The Open Protein Structure Annotation Network
PDB Keyword
.

422686

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Diffraction-quality Crystals
    Target Id 422686
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS67287,BC031079 Molecular Weight 11826.93 Da.
    Residues 107 Isoelectric Point 9.17
    Sequence nqnlltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfidkqtnlskcfgfv sydnpvsaqaaiqsmngfqigmkrlkvqlkrskndskp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch