.
The Open Protein Structure Annotation Network
PDB Keyword
.

422741

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG Biology Target:
    Status Crystallized
    Target Id 422741
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS72320,BC046625 Molecular Weight 48125.81 Da.
    Residues 426 Isoelectric Point 6.39
    Sequence mskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqthakr ayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhermsyllyqmlcg ikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvvtryyrapevilgmgykenvd iwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrnyvenrpkyagltfpklfp dslfpadsehnklkasqardllskmlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlder ehtieewkeliykevmnseektkngvvkgqpspsgaavnsseslppsssvndissmstdqtlasdtdss leasagplgccr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch