The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 423075
    Molecular Characteristics
    Source Arthrobacter sp. fb24
    Alias Ids TPS72224,ARTH_26JUL04_CONTIG43_REVISED_GENE2419 Molecular Weight 14430.00 Da.
    Residues 135 Isoelectric Point 5.40
    Sequence msrfvvitaaqdfqrkvqsavrgalhgtvqilppsvmlggpqelfgrlsgeppevlvlgpglpgdealk latvfdlqypeislvlvedmaseqvinamragirdivspsaevselrilleraclasagrrrglva
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch