The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 424709
    Molecular Characteristics
    Source Escherichia coli str. k-12 substr. mg1655
    Alias Ids TPS73754,NP_418164.4, 3.40.640.10 Molecular Weight 52770.70 Da.
    Residues 471 Isoelectric Point 5.88
    Sequence menfkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmqaammr gdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgldrskmvafsnyffdt tqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevgpnnvpyivatitsnsaggqpvsl anlkamysiakkydipvvmdsarfaenayfikqreaeykdwtieqitretykyadmlamsakkdamvpm ggllcmkddsffdvytecrtlcvvqegfptyggleggamerlavglydgmnldwlayriaqvqylvdgl eeigvvcqqagghaafvdagkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcp aellrltipratytqthmdfiieafkhvkenaanikgltftyepkvlrhftaklkev
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch